PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00318.1_g00013.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family Dof
Protein Properties Length: 307aa    MW: 32924 Da    PI: 9.496
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00318.1_g00013.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.51.4e-3877136362
                   zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                              e+alkcprC+stntkfCy+nnysl+qPr+fCk+CrryWt+GGalrnvPvGgg r+n++++
  Rsa1.0_00318.1_g00013.1  77 EAALKCPRCESTNTKFCYFNNYSLTQPRHFCKTCRRYWTRGGALRNVPVGGGFRRNRRTK 136
                              6789*****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-3564134IPR003851Zinc finger, Dof-type
PfamPF027015.1E-3279134IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.11580134IPR003851Zinc finger, Dof-type
PROSITE patternPS01361082118IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
MVFSSIQGYL DSSNWQQSPP SNYNQGGERA SATGGHGFVP QLQPLSQPQS NGSGSSGSIR  60
PGSMVDRARQ ANVAIPEAAL KCPRCESTNT KFCYFNNYSL TQPRHFCKTC RRYWTRGGAL  120
RNVPVGGGFR RNRRTKSSNN NNSTATSNNT SFSSAASGNA STISAILSSN YGGNQESFLS  180
QILSPMKLMN TTNTTDNSMS LLNCGGLNQD LRTIQMGSSG GSLMSCVNEW RSTHHQQPHS  240
LGGGNCGDSS NTNPSSNGFY AFESPRITSA LASHISSVKA EDNPYKWVNV NGNCSSWTDL  300
SSFGSSR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1120133RNVPVGGGFRRNRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1893070.0AC189307.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB033O04, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013634080.10.0PREDICTED: dof zinc finger protein DOF2.4-like
RefseqXP_013680574.10.0PREDICTED: dof zinc finger protein DOF2.4-like
SwissprotO809281e-146DOF24_ARATH; Dof zinc finger protein DOF2.4
TrEMBLA0A078DVI20.0A0A078DVI2_BRANA; BnaC04g45310D protein
TrEMBLA0A0D3C4U00.0A0A0D3C4U0_BRAOL; Uncharacterized protein
STRINGBra017171.1-P1e-159(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM113541732
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37590.11e-126DNA binding with one finger 2.4